PDB entry 1wub

View 1wub on RCSB PDB site
Description: Crystal structure of the polyisoprenoid-binding protein, TT1927b, from Thermus thermophilus HB8
Class: lipid binding protein
Keywords: beta-barrel, STRUCTURAL GENOMICS, RIKEN Structural Genomics/Proteomics Initiative, RSGI, LIPID BINDING PROTEIN
Deposited on 2004-12-03, released 2004-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.221
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein TT1927b
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wuba_
  • Heterogens: OTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wubA (A:)
    mkwnldpshtsidfkvrhmgiasvrgslkvlsgsvetdeagrpiqveavidaasiatgep
    qrdghlrsadflhaeqypeirfvstqieplggnryriqgnltirditkpvtleaevsapi
    kdpwgmqrvaasasgqinrkdwnltwnqvlelgallvgeevkfnleveavapapvaaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wubA (A:)
    mkwnldpshtsidfkvrhmgiasvrgslkvlsgsvetdeagrpiqveavidaasiatgep
    qrdghlrsadflhaeqypeirfvstqieplggnryriqgnltirditkpvtleaevsapi
    kdpwgmqrvaasasgqinrkdwnltwnqvlelgallvgeevkfnleveavapapva