PDB entry 1wu9

View 1wu9 on RCSB PDB site
Description: Crystal structure of the C-terminal domain of the end-binding protein 1 (EB1)
Class: structural protein
Keywords: EB1-like structural motif, APC/dynactin binding domain, Coiled coil, STRUCTURAL PROTEIN
Deposited on 2004-12-02, released 2005-02-01
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: 0.183
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Microtubule-associated protein RP/EB family member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: EB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1wu9a1
  • Chain 'B':
    Compound: Microtubule-associated protein RP/EB family member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: EB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1wu9b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wu9A (A:)
    gsdeaaelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilya
    tdegfvipdeggpqeeqeey
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wu9A (A:)
    deaaelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilyat
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wu9B (B:)
    gsdeaaelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilya
    tdegfvipdeggpqeeqeey
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wu9B (B:)
    deaaelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilyatd
    egfvipd