PDB entry 1wu8

View 1wu8 on RCSB PDB site
Description: Crystal structure of project PH0463 from Pyrococcus horikoshii OT3
Deposited on 2004-12-02, released 2005-11-29
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.195
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PH0463
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O58212 (0-255)
      • modified residue (0)
      • modified residue (17)
      • modified residue (21)
      • modified residue (49)
      • modified residue (219)
      • modified residue (235)
  • Chain 'B':
    Compound: hypothetical protein PH0463
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O58212 (0-255)
      • modified residue (0)
      • modified residue (17)
      • modified residue (21)
      • modified residue (49)
      • modified residue (219)
      • modified residue (235)
  • Chain 'C':
    Compound: hypothetical protein PH0463
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O58212 (0-255)
      • modified residue (0)
      • modified residue (17)
      • modified residue (21)
      • modified residue (49)
      • modified residue (219)
      • modified residue (235)
  • Heterogens: ADN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1wu8A (A:)
    mitlttdfglkgpyvgemkvamlrinpnakivdvthsvtrhsilegsfvmeqvvkyspkg
    tvhvgvidpgvgterraiviegdqylvvpdnglatlplkhikvksvyeiipdkirkftgw
    eisstfhgrdifgpagaliekgihpeefgreipvdsivklnveprkegdvwilkviyidd
    fgnvilnlenyekprtvelldfnlrlpyletyglvekgemlalpgshdyleiavnmgsaa
    erlnvkvgdelrvrll
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >1wu8B (B:)
    mitlttdfglkgpyvgemkvamlrinpnakivdvthsvtrhsilegsfvmeqvvkyspkg
    tvhvgvidpgvgterraiviegdqylvvpdnglatlplkhikvksvyeiipdkirkftgw
    eisstfhgrdifgpagaliekgihpeefgreipvdsivklnveprkegdvwilkviyidd
    fgnvilnlenyekprtvelldfnlrlpyletyglvekgemlalpgshdyleiavnmgsaa
    erlnvkvgdelrvrll
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >1wu8C (C:)
    mitlttdfglkgpyvgemkvamlrinpnakivdvthsvtrhsilegsfvmeqvvkyspkg
    tvhvgvidpgvgterraiviegdqylvvpdnglatlplkhikvksvyeiipdkirkftgw
    eisstfhgrdifgpagaliekgihpeefgreipvdsivklnveprkegdvwilkviyidd
    fgnvilnlenyekprtvelldfnlrlpyletyglvekgemlalpgshdyleiavnmgsaa
    erlnvkvgdelrvrll