PDB entry 1wu5

View 1wu5 on RCSB PDB site
Description: Crystal structure of reducing-end-xylose releasing exo-oligoxylanase complexed with xylose
Class: hydrolase
Keywords: (alpla/alpha)6 barrel, glycoside hydrolase family 8, HYDROLASE
Deposited on 2004-12-01, released 2005-02-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.171
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Xylanase Y
    Species: BACILLUS HALODURANS [TaxId:272558]
    Gene: BH2105
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wu5a_
  • Heterogens: XYP, NI, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wu5A (A:)
    mekttegafytreyrnlfkefgyseaeiqervkdtweqlfgdnpetkiyyevgddlgyll
    dtgnldvrtegmsygmmmavqmdrkdifdriwnwtmknmymtegvhagyfawscqpdgtk
    nswgpapdgeeyfalalffashrwgdgdeqpfnyseqarkllhtcvhngeggpghpmwnr
    dnklikfipevefsdpsyhlphfyelfslwaneedrvfwkeaaeasreylkiachpetgl
    apeyayydgtpndekgyghffsdsyrvaanigldaewfggsewsaeeinkiqaffadkep
    edyrrykidgepfeekslhpvgliatnamgslasvdgpyakanvdlfwntpvrtgnrryy
    dnclylfamlalsgnfkiwfpegqeeehlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wu5A (A:)
    egafytreyrnlfkefgyseaeiqervkdtweqlfgdnpetkiyyevgddlgylldtgnl
    dvrtegmsygmmmavqmdrkdifdriwnwtmknmymtegvhagyfawscqpdgtknswgp
    apdgeeyfalalffashrwgdgdeqpfnyseqarkllhtcvhngeggpghpmwnrdnkli
    kfipevefsdpsyhlphfyelfslwaneedrvfwkeaaeasreylkiachpetglapeya
    yydgtpndekgyghffsdsyrvaanigldaewfggsewsaeeinkiqaffadkepedyrr
    ykidgepfeekslhpvgliatnamgslasvdgpyakanvdlfwntpvrtgnrryydncly
    lfamlalsgnfkiwfp