PDB entry 1wu2

View 1wu2 on RCSB PDB site
Description: Crystal Structure of molybdopterin biosynthesis moeA protein from Pyrococcus horikoshii OT3
Deposited on 2004-11-30, released 2004-12-07
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-07, with a file datestamp of 2004-12-07.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.236
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wu2A (A:)
    mmefkklvpyrealklllddineiedtekvplreavgrvlaedivtefdippfdraavdg
    yairaedtfqareynpieltvieevpagnvakeevttgkaikvltgtripkganavimqe
    mvkregdkiyvlrpvapgqniaftgedvkkgevvlrkgtilrpqdvamlkalgikkvpvk
    vkpkvgiiitgselieepseegfkegkivetnsimlqglvekffgepilygvlpddesii
    ketlekaknecdivlitggsafgdkdyahkfvnllfhgttikpgrpfgygekvfimsgyp
    vsvfaqfnlfvkhalakmvgaqnyevkvkailqddipsqlgryefikiyyengiarvikk
    kgsgilssllasnayleipedsegyrrgeevwitly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wu2A (A:)
    klvpyrealklllddineiedtekvplreavgrvlaedivtefdippfdraavdgyaira
    edtfqareynpieltvieevpagnvakeevttgkaikvltgtripkganavimqemvkre
    gdkiyvlrpvapgqniaftgedvkkgevvlrkgtilrpqdvamlkalgikkvpvkvkpkv
    giiitgselieepseegfkegkivetnsimlqglvekffgepilygvlpddesiiketle
    kaknecdivlitdyahkfvnllfhgttikpgrpfgygekvfimsgypvsvfaqfnlfvkh
    alakmvgaqnyevkvkailqddipsqlgryefikiyyengiarvikkkgsgilssllasn
    ayleipedsegyrrgeevwitly
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wu2B (B:)
    mmefkklvpyrealklllddineiedtekvplreavgrvlaedivtefdippfdraavdg
    yairaedtfqareynpieltvieevpagnvakeevttgkaikvltgtripkganavimqe
    mvkregdkiyvlrpvapgqniaftgedvkkgevvlrkgtilrpqdvamlkalgikkvpvk
    vkpkvgiiitgselieepseegfkegkivetnsimlqglvekffgepilygvlpddesii
    ketlekaknecdivlitggsafgdkdyahkfvnllfhgttikpgrpfgygekvfimsgyp
    vsvfaqfnlfvkhalakmvgaqnyevkvkailqddipsqlgryefikiyyengiarvikk
    kgsgilssllasnayleipedsegyrrgeevwitly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wu2B (B:)
    klvpyrealklllddineiedtekvplreavgrvlaedivtefdippfdraavdgyaira
    edtfqareynpieltvieevpagnvakeevttgkaikvltgtripkganavimqemvkre
    gdkiyvlrpvapgqniaftgedvkkgevvlrkgtilrpqdvamlkalgikkvpvkvkpkv
    giiitgselieepseegfkegkivetnsimlqglvekffgepilygvlpddesiiketle
    kaknecdivlitgfvnllfhgttikpgrpfgygekvfimsgypvsvfaqfnlfvkhalak
    mvgaqnyevkvkailqddipsqlgryefikiyyengiarvikkkgsgilssllasnayle
    ipedsegyrrgeevwitly