PDB entry 1wu0

View 1wu0 on RCSB PDB site
Description: Solution structure of subunit c of F1Fo-ATP synthase from the thermophilic bacillus PS3
Deposited on 2004-11-29, released 2005-12-13
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP synthase c chain
    Species: Bacillus sp. PS3 [TaxId:2334]
    Gene: atpE
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1wu0A (A:)
    mslgvlaaaiavglgalgagignglivsrtiegiarqpelrpvlqttmfigvalvealpi
    igvvfsfiylgr