PDB entry 1wty

View 1wty on RCSB PDB site
Description: Crystal structure of a probable nucleotidyl transferase protein from thermus thermophilus HB8
Deposited on 2004-11-29, released 2004-12-07
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-07, with a file datestamp of 2004-12-07.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.23
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1wtya_
  • Chain 'B':
    Domains in SCOP 1.71: d1wtyb_
  • Chain 'C':
    Domains in SCOP 1.71: d1wtyc_
  • Chain 'D':
    Domains in SCOP 1.71: d1wtyd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wtyA (A:)
    maslaraverlkaalerpkdefirdsaiqrfeftfelawktlktflelqglearspraai
    rgafqvgllpedpfwlemlelrnltnhtydealaeriyaelpkalerfqellrrleepa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wtyA (A:)
    aslaraverlkaalerpkdefirdsaiqrfeftfelawktlktflelqglearspraair
    gafqvgllpedpfwlemlelrnltnhtydealaeriyaelpkalerfqellrrlee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wtyB (B:)
    maslaraverlkaalerpkdefirdsaiqrfeftfelawktlktflelqglearspraai
    rgafqvgllpedpfwlemlelrnltnhtydealaeriyaelpkalerfqellrrleepa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wtyB (B:)
    slaraverlkaalerpkdefirdsaiqrfeftfelawktlktflelqglearspraairg
    afqvgllpedpfwlemlelrnltnhtydealaeriyaelpkalerfqellrrle
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1wtyC (C:)
    maslaraverlkaalerpkdefirdsaiqrfeftfelawktlktflelqglearspraai
    rgafqvgllpedpfwlemlelrnltnhtydealaeriyaelpkalerfqellrrleepa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wtyC (C:)
    aslaraverlkaalerpkdefirdsaiqrfeftfelawktlktflelqglearspraair
    gafqvgllpedpfwlemlelrnltnhtydealaeriyaelpkalerfqellrrle
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1wtyD (D:)
    maslaraverlkaalerpkdefirdsaiqrfeftfelawktlktflelqglearspraai
    rgafqvgllpedpfwlemlelrnltnhtydealaeriyaelpkalerfqellrrleepa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wtyD (D:)
    slaraverlkaalerpkdefirdsaiqrfeftfelawktlktflelqglearspraairg
    afqvgllpedpfwlemlelrnltnhtydealaeriyaelpkalerfqellrrle