PDB entry 1wtu

View 1wtu on RCSB PDB site
Description: transcription factor 1, nmr, minimized average structure
Class: transcription factor
Keywords: transcription factor, type II DNA-binding protein, nmr
Deposited on 1996-07-29, released 1997-02-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: transcription factor 1
  Species: Bacillus phage SPO1 [TaxId:10685]
  Gene: TF1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04445 (0-98)
  Domains in SCOPe 2.08: d1wtua_
• Chain 'B':
  Compound: transcription factor 1
  Species: Bacillus phage SPO1 [TaxId:10685]
  Gene: TF1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04445 (0-98)
  Domains in SCOPe 2.08: d1wtub_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wtuA (A:)
  mnktelikaiaqdteltqvsvskmlasfekittetvakgdkvqltgflnikpvarqarkg
  fnpqtqealeiapsvgvsvkpgeslkkaaeglkyedfak
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wtuB (B:)
  mnktelikaiaqdteltqvsvskmlasfekittetvakgdkvqltgflnikpvarqarkg
  fnpqtqealeiapsvgvsvkpgeslkkaaeglkyedfak