PDB entry 1wtl
View 1wtl on RCSB PDB site
Description: comparison of crystal structures of two homologous proteins: structural origin of altered domain interactions in immunoglobulin light chain dimers
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on
1994-06-08, released
1994-11-01
The last revision prior to the SCOPe 2.04 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.157
AEROSPACI score: 0.45
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: bence-jones protein mcg (light chain)
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d1wtla_ - Chain 'B':
Compound: bence-jones protein mcg (light chain)
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d1wtlb_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1wtlA (A:)
diqmtqspsslsasvgdrvtitcrasqditnyvnwfqqrpgqapkvliygasiletgvps
rfsgsgsgtdftftisslqpediatyycqqydtlpltfgggtkvdikr
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1wtlB (B:)
diqmtqspsslsasvgdrvtitcrasqditnyvnwfqqrpgqapkvliygasiletgvps
rfsgsgsgtdftftisslqpediatyycqqydtlpltfgggtkvdikr