PDB entry 1wtl

View 1wtl on RCSB PDB site
Description: comparison of crystal structures of two homologous proteins: structural origin of altered domain interactions in immunoglobulin light chain dimers
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1994-06-08, released 1994-11-01
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.157
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: bence-jones protein mcg (light chain)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P80362 (0-107)
  Domains in SCOPe 2.01: d1wtla_
• Chain 'B':
  Compound: bence-jones protein mcg (light chain)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P80362 (0-107)
  Domains in SCOPe 2.01: d1wtlb_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wtlA (A:)
  diqmtqspsslsasvgdrvtitcrasqditnyvnwfqqrpgqapkvliygasiletgvps
  rfsgsgsgtdftftisslqpediatyycqqydtlpltfgggtkvdikr
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wtlB (B:)
  diqmtqspsslsasvgdrvtitcrasqditnyvnwfqqrpgqapkvliygasiletgvps
  rfsgsgsgtdftftisslqpediatyycqqydtlpltfgggtkvdikr