PDB entry 1wtl

View 1wtl on RCSB PDB site
Description: comparison of crystal structures of two homologous proteins: structural origin of altered domain interactions in immunoglobulin light chain dimers
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1994-06-08, released 1994-11-01
The last revision prior to the SCOP 1.75 freeze date was dated 1994-11-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.157
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bence-jones protein mcg (light chain)
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1wtla_
  • Chain 'B':
    Compound: bence-jones protein mcg (light chain)
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1wtlb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wtlA (A:)
    diqmtqspsslsasvgdrvtitcrasqditnyvnwfqqrpgqapkvliygasiletgvps
    rfsgsgsgtdftftisslqpediatyycqqydtlpltfgggtkvdikr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wtlB (B:)
    diqmtqspsslsasvgdrvtitcrasqditnyvnwfqqrpgqapkvliygasiletgvps
    rfsgsgsgtdftftisslqpediatyycqqydtlpltfgggtkvdikr