PDB entry 1wtl

View 1wtl on RCSB PDB site
Description: comparison of crystal structures of two homologous proteins: structural origin of altered domain interactions in immunoglobulin light chain dimers
Deposited on 1994-06-08, released 1994-11-01
The last revision prior to the SCOP 1.67 freeze date was dated 1994-11-01, with a file datestamp of 1994-11-11.
Experiment type: -
Resolution: 1.9 Å
R-factor: 0.157
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1wtla_
  • Chain 'B':
    Domains in SCOP 1.67: d1wtlb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wtlA (A:)
    diqmtqspsslsasvgdrvtitcrasqditnyvnwfqqrpgqapkvliygasiletgvps
    rfsgsgsgtdftftisslqpediatyycqqydtlpltfgggtkvdikr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wtlB (B:)
    diqmtqspsslsasvgdrvtitcrasqditnyvnwfqqrpgqapkvliygasiletgvps
    rfsgsgsgtdftftisslqpediatyycqqydtlpltfgggtkvdikr