PDB entry 1wtj

View 1wtj on RCSB PDB site
Description: Crystal Structure of delta1-piperideine-2-carboxylate reductase from Pseudomonas syringae pvar.tomato
Class: oxidoreductase
Keywords: NADPH dependent enzyme, OXIDOREDUCTASE
Deposited on 2004-11-24, released 2005-10-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.194
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ureidoglycolate Dehydrogenase
    Species: Pseudomonas syringae group genomosp. 3 [TaxId:323]
    Gene: dpkA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4U331
      • conflict (11)
      • conflict (15)
      • conflict (27)
      • conflict (111)
    Domains in SCOPe 2.07: d1wtja_
  • Chain 'B':
    Compound: Ureidoglycolate Dehydrogenase
    Species: Pseudomonas syringae group genomosp. 3 [TaxId:323]
    Gene: dpkA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4U331 (Start-342)
      • conflict (11)
      • conflict (15)
      • conflict (27)
      • conflict (111)
    Domains in SCOPe 2.07: d1wtjb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wtjA (A:)
    msashadqptqtvsypqlidllrrifvvhgtspevadvlaencasaqrdgshshgifrip
    gylsslasgwvdgkavpvvedvgaafvrvdacngfaqpalaaarsllidkarsagvaila
    irgshhfaalwpdvepfaeqglvalsmvnsmtcvvphgarqplfgtnpiafgapraggep
    ivfdlatsaiahgdvqiaaregrllpagmgvdrdglptqepraildggallpfgghkgsa
    lsmmvellaagltggnfsfefdwskhpgaqtpwtgqllividpdkgagqhfaqrseelvr
    qlhgvgqerlpgdrrylerarsmahgiviaqadlerlqelagh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wtjA (A:)
    tqtvsypqlidllrrifvvhgtspevadvlaencasaqrdgshshgifripgylsslasg
    wvdgkavpvvedvgaafvrvdacngfaqpalaaarsllidkarsagvailairgshhfaa
    lwpdvepfaeqglvalsmvnsmtcvvphgarqplfgtnpiafgapraggepivfdlatsa
    iahgdvqiaaregrllpagmgvdrdglptqepraildggallpfgghkgsalsmmvella
    agltggnfsfefdwskhpgaqtpwtgqllividpdkgagqhfaqrseelvrqlhgvgqer
    lpgdrrylerarsmahgiviaqadlerlqela
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wtjB (B:)
    msashadqptqtvsypqlidllrrifvvhgtspevadvlaencasaqrdgshshgifrip
    gylsslasgwvdgkavpvvedvgaafvrvdacngfaqpalaaarsllidkarsagvaila
    irgshhfaalwpdvepfaeqglvalsmvnsmtcvvphgarqplfgtnpiafgapraggep
    ivfdlatsaiahgdvqiaaregrllpagmgvdrdglptqepraildggallpfgghkgsa
    lsmmvellaagltggnfsfefdwskhpgaqtpwtgqllividpdkgagqhfaqrseelvr
    qlhgvgqerlpgdrrylerarsmahgiviaqadlerlqelagh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wtjB (B:)
    dqptqtvsypqlidllrrifvvhgtspevadvlaencasaqrdgshshgifripgylssl
    asgwvdgkavpvvedvgaafvrvdacngfaqpalaaarsllidkarsagvailairgshh
    faalwpdvepfaeqglvalsmvnsmtcvvphgarqplfgtnpiafgapraggepivfdla
    tsaiahgdvqiaaregrllpagmgvdrdglptqepraildggallpfgghkgsalsmmve
    llaagltggnfsfefdwskhpgaqtpwtgqllividpdkgagqhfaqrseelvrqlhgvg
    qerlpgdrrylerarsmahgiviaqadlerlqelagh