PDB entry 1wth

View 1wth on RCSB PDB site
Description: Crystal structure of gp5-S351L mutant and gp27 complex
Class: Hydrolase/Structural protein
Keywords: Triple-stranded beta-helix, OB fold, pseudohexamer, T4 tail lysozyme, HUB, gp5-gp27, Hydrolase-Structural protein COMPLEX
Deposited on 2004-11-23, released 2005-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.217
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tail-associated lysozyme
    Species: Enterobacteria phage T4 [TaxId:10665]
    Gene: 5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16009 (Start-574)
      • engineered (350)
      • expression tag (575)
  • Chain 'D':
    Compound: Baseplate structural protein Gp27
    Species: Enterobacteria phage T4 [TaxId:10665]
    Gene: 27
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wthd1, d1wthd2
  • Heterogens: K, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1wthD (D:)
    msmlqrpgypnlsvklfdsydawsnnrfvelaatittltmrdslygrnegmlqfydskni
    htkmdgneiiqisvanandinnvktriygckhfsvsvdskgdniiaielgtihsienlkf
    grpffpdagesikemlgviyqdrtlltpainainayvpdipwtstfenylsyvrevalav
    gsdkfvfvwqdimgvnmmdydmminqepypmivgepsligqfiqelkyplaydfvwltks
    nphkrdpmknatiyahsfldssipmittgkgensivvsrsgaysemtyrngyeeairlqt
    maqydgyakcstignfnltpgvkiifndsknqfktefyvdevihelsnnnsvthlymftn
    atkletidpvkvknefksdttteessssnkq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wthD (D:)
    lqrpgypnlsvklfdsydawsnnrfvelaatittltmrdslygrnegmlqfydsknihtk
    mdgneiiqisvanandinnvktriygckhfsvsiiaielgtihsienlkfgrpffpdage
    sikemlgviyqdrtlltpainainayvpdipwtstfenylsyvrevalavgsdkfvfvwq
    dimgvnmmdydmminqepypmivgepsqelkyplaydfvwltksnphkrdpmknatiyah
    sfldssipmittgkgensivvsrsgaysemtyrngyeeairlqtmaqydgyakcstignf
    nltpgvkiifndsknqfktefyvdevihelsnnnsvthlymftnatkletidpvkvknef
    k