PDB entry 1wtf

View 1wtf on RCSB PDB site
Description: Crystal structure of Bacillus thermoproteolyticus Ferredoxin Variants Containing Unexpected [3Fe-4S] Cluster that is linked to Coenzyme A at 1.6 A Resolution
Class: electron transport
Keywords: 3Fe-4S cluster, Coenzyme A, Ferredoxin, Complex, ELECTRON TRANSPORT
Deposited on 2004-11-22, released 2005-11-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.182
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ferredoxin
  Species: Bacillus thermoproteolyticus [TaxId:1427]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P10245 (0-80)
  Domains in SCOPe 2.07: d1wtfa_
• Chain 'B':
  Compound: ferredoxin
  Species: Bacillus thermoproteolyticus [TaxId:1427]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P10245 (0-80)
  Domains in SCOPe 2.07: d1wtfb_
• Chain 'C':
  Compound: ferredoxin
  Species: Bacillus thermoproteolyticus [TaxId:1427]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P10245 (0-80)
  Domains in SCOPe 2.07: d1wtfc_
• Chain 'D':
  Compound: ferredoxin
  Species: Bacillus thermoproteolyticus [TaxId:1427]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P10245 (0-80)
  Domains in SCOPe 2.07: d1wtfd_
• Heterogens: SO4, COA, F3S, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wtfA (A:)
  pkytivdketciacgacgaaapdiydydedgiayvtlddnqgivevpdiliddmmdafeg
  cptdsikvadepfdgdpnkfe
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wtfB (B:)
  pkytivdketciacgacgaaapdiydydedgiayvtlddnqgivevpdiliddmmdafeg
  cptdsikvadepfdgdpnkfe
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wtfC (C:)
  pkytivdketciacgacgaaapdiydydedgiayvtlddnqgivevpdiliddmmdafeg
  cptdsikvadepfdgdpnkfe
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wtfD (D:)
  pkytivdketciacgacgaaapdiydydedgiayvtlddnqgivevpdiliddmmdafeg
  cptdsikvadepfdgdpnkfe