PDB entry 1wtd

View 1wtd on RCSB PDB site
Description: Crystal structure of type II restrcition endonuclease, EcoO109I DNA-free form
Class: hydrolase
Keywords: restriction endonuclease, DNA-free from, hydrolase
Deposited on 2004-11-22, released 2004-12-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.257
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: EcoO109IR
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1wtda_
  • Chain 'B':
    Compound: EcoO109IR
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1wtdb_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wtdA (A:)
    mnkqevilkvqecaawwilerqskltklmsetmsinpfmtpfifdyhslndfdelveaii
    akhlmtghdtgfgklidekilprvfgaykldksyraanepfihpcfdeidhviqrddgri
    ellslkagkwtiqltmavqlnkafheiinnypgvadnivvgvfygnshgltdkyrilrgi
    ntganhnvidirdkvhvyagkefwswlnngeaetqhwvlegieravkeadikeknkdlie
    kfkehvakkyneqvlnadgtaqwhkllemine
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wtdA (A:)
    mnkqevilkvqecaawwilerqskltklmsetmsinpfmtpfifdyhslndfdelveaii
    akhlmtghdtgfgklidekilprvfgaykldkfihpcfdeidhviqrddgriellslkag
    kwtiqltmavqlnkafheiinnypgvadnivvgvfygnshgltdkyrilrgintganhnv
    idirdkvhvyagkefwswlnngeaetqhwvlegieravkeadikeknkdliekfkehvak
    kyneqvlnadgtaqwhkllemine
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wtdB (B:)
    mnkqevilkvqecaawwilerqskltklmsetmsinpfmtpfifdyhslndfdelveaii
    akhlmtghdtgfgklidekilprvfgaykldksyraanepfihpcfdeidhviqrddgri
    ellslkagkwtiqltmavqlnkafheiinnypgvadnivvgvfygnshgltdkyrilrgi
    ntganhnvidirdkvhvyagkefwswlnngeaetqhwvlegieravkeadikeknkdlie
    kfkehvakkyneqvlnadgtaqwhkllemine
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wtdB (B:)
    mnkqevilkvqecaawwilerqskltklmsetmsinpfmtpfifdyhslndfdelveaii
    akhlmtghdtgfgklidekilprvfgaykldksyraanepfihpcfdeidhviqrddgri
    ellslkagkwtiqltmavqlnkafheiinnypgvadnivvgvfygnshgltdkyrilgan
    hnvidirdkvhvyagkefwswlnngeaetqhwvlegieravkeadikeknkdliekfkeh
    vakkyneqvlnadgtaqwhkllemine