PDB entry 1wtb

View 1wtb on RCSB PDB site
Description: Complex structure of the C-terminal RNA-binding domain of hnRNP D (AUF1) with telomere DNA
Class: transcription/DNA
Keywords: RNA-binding domain, DNA-binding domain, RRM, hnRNP D, AUF1, Telomere, Complex, structural genomics, TRANSCRIPTION/DNA COMPLEX
Deposited on 2004-11-22, released 2005-04-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heterogeneous nuclear ribonucleoprotein D0
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wtba_
  • Chain 'B':
    Compound: 5'-d(p*tp*ap*gp*g)-3'

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wtbA (A:)
    vkkifvgglspdtpeekireyfggfgevesielpmdnktnkrrgfcfitfkeeepvkkim
    ekkyhnvglskceikvams
    

  • Chain 'B':
    No sequence available.