PDB entry 1wta

View 1wta on RCSB PDB site
Description: Crystal Structure of 5'-Deoxy-5'-methylthioadenosine from Aeropyrum pernix (R32 form)
Class: transferase
Keywords: a/b structure, transferase
Deposited on 2004-11-18, released 2006-02-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-methylthioadenosine phosphorylase
    Species: Aeropyrum pernix [TaxId:272557]
    Database cross-references and differences (RAF-indexed):
    • GB NP_148238 (Start-274)
    Domains in SCOPe 2.07: d1wtaa_
  • Heterogens: PO4, ADE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wtaA (A:)
    mfeitrppgvrahvgviggsglydpgivenpvevkvstpygnpsdfivvgdvagvkvafl
    prhgrghripphainyraniwalkalgvkwvisvsavgslredyrpgdfvvpdqfidmtk
    nrrhytfydgpvtvhvsmadpfcedlrqrlidsgrrlgytvhergtyvciegprfstrae
    srvwkdvfkadiigmtlvpeinlaceaqlcyatlamvtdydvwadrpvtaeevervmisn
    verarrmlydvipklagepelercsccraldtaai
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wtaA (A:)
    eitrppgvrahvgviggsglydpgivenpvevkvstpygnpsdfivvgdvagvkvaflpr
    hgrghripphainyraniwalkalgvkwvisvsavgslredyrpgdfvvpdqfidmtknr
    rhytfydgpvtvhvsmadpfcedlrqrlidsgrrlgytvhergtyvciegprfstraesr
    vwkdvfkadiigmtlvpeinlaceaqlcyatlamvtdydvwadrpvtaeevervmisnve
    rarrmlydvipklagepelercsccraldtaai