PDB entry 1wt7

View 1wt7 on RCSB PDB site
Description: Solution structure of BuTX-MTX: a butantoxin-maurotoxin chimera
Class: toxin
Keywords: Maurotoxin, Butantoxin, Scorpion toxin, K+ channels, molecular contacts, toxin affinity
Deposited on 2004-11-16, released 2004-11-30
The last revision prior to the SCOP 1.75 freeze date was dated 2005-08-02, with a file datestamp of 2007-06-04.
Experiment type: NMR25
Resolution: N/A
R-factor: N/A
AEROSPACI score: -1.93 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: BuTX-MTX
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P59936 (0-8)
  • Uniprot P80719 (9-40)
  Domains in SCOP 1.75: d1wt7a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wt7A (A:)
  wcstcldlactgskdcyapcrkqtgcpnakcinksckcygc