PDB entry 1wt7

View 1wt7 on RCSB PDB site
Description: solution structure of butx-mtx: a butantoxin-maurotoxin chimera
Deposited on 2004-11-16, released 2004-11-30
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-30, with a file datestamp of 2004-11-30.
Experiment type: NMR25
Resolution: N/A
R-factor: N/A
AEROSPACI score: -1.96 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1wt7a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wt7A (A:)
    wcstcldlactgskdcyapcrkqtgcpnakcinksckcygc