PDB entry 1wt5

View 1wt5 on RCSB PDB site
Description: The Crystal Structure Of A Humanized Antibody Fv 528
Class: immune system
Keywords: humanized antibody, immune system
Deposited on 2004-11-16, released 2005-05-16
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.273
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: anti egfr antibody fv region
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1WT5 (0-End)
    Domains in SCOPe 2.04: d1wt5a_
  • Chain 'B':
    Compound: anti egfr antibody fv region
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1WT5 (0-End)
    Domains in SCOPe 2.04: d1wt5b_
  • Chain 'C':
    Compound: anti egfr antibody fv region
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1WT5 (0-End)
    Domains in SCOPe 2.04: d1wt5c_
  • Chain 'D':
    Compound: anti egfr antibody fv region
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1WT5 (0-End)
    Domains in SCOPe 2.04: d1wt5d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wt5A (A:)
    qvqlvqsgaevkkpgasvkvsckasgytftsywmhwvrqapgqglewmgniypgsggtny
    aekfknrvtmtrdtsistaymelsrlrsddtavyycarsggpyffdywgqgtlvtvssaa
    ahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wt5A (A:)
    qvqlvqsgaevkkpgasvkvsckasgytftsywmhwvrqapgqglewmgniypgsggtny
    aekfknrvtmtrdtsistaymelsrlrsddtavyycarsggpyffdywgqgtlvt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wt5B (B:)
    qvqlvqsgaevkkpgasvkvsckasgytftsywmhwvrqapgqglewmgniypgsggtny
    aekfknrvtmtrdtsistaymelsrlrsddtavyycarsggpyffdywgqgtlvtvssaa
    ahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wt5B (B:)
    qvqlvqsgaevkkpgasvkvsckasgytftsywmhwvrqapgqglewmgniypgsggtny
    aekfknrvtmtrdtsistaymelsrlrsddtavyycarsggpyffdywgqgtlvt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1wt5C (C:)
    divmtqsplslpvtpgepasiscrssqnivhnngitylewylqkpgqspqlliykvsdrf
    sgvpdrfsgsgsgtdftlkisrveaedvgvyycfqgshipptfgqgtkveikraaahhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wt5C (C:)
    divmtqsplslpvtpgepasiscrssqnivhnngitylewylqkpgqspqlliykvsdrf
    sgvpdrfsgsgsgtdftlkisrveaedvgvyycfqgshipptfgqgtkvei
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1wt5D (D:)
    divmtqsplslpvtpgepasiscrssqnivhnngitylewylqkpgqspqlliykvsdrf
    sgvpdrfsgsgsgtdftlkisrveaedvgvyycfqgshipptfgqgtkveikraaahhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wt5D (D:)
    divmtqsplslpvtpgepasiscrssqnivhnngitylewylqkpgqspqlliykvsdrf
    sgvpdrfsgsgsgtdftlkisrveaedvgvyycfqgshipptfgqgtkvei