PDB entry 1wt4

View 1wt4 on RCSB PDB site
Description: Crystal structure of rat Tom20-ALDH presequence complex
Deposited on 2004-11-15, released 2005-11-22
The last revision was dated 2007-06-12, with a file datestamp of 2007-06-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.184
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mitochondrial import receptor subunit tom20 homolog
    Species: Rattus norvegicus
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q62760 (5-72)
      • cloning artifact (0-4)
      • modified residue (67)
  • Chain 'B':
    Compound: mitochondrial import receptor subunit tom20 homolog
    Species: Rattus norvegicus
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q62760 (5-72)
      • modified residue (67)
  • Chain 'C':
    Compound: aldehyde dehydrogenase, mitochondrial
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11884 (0-10)
      • engineered (11)
      • cloning artifact (12)
  • Chain 'D':
    Compound: aldehyde dehydrogenase, mitochondrial
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11884 (0-10)
      • engineered (11)
      • cloning artifact (12)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1wt4A (A:)
    gplgsdlkdaeavqkffleeiqlgeellaqgdyekgvdhltnaiavcgqpqqllqvlqqt
    lpppvfqmlltkl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1wt4B (B:)
    gplgsdlkdaeavqkffleeiqlgeellaqgdyekgvdhltnaiavcgqpqqllqvlqqt
    lpppvfqmlltkl
    

    Sequence, based on observed residues (ATOM records):
    >1wt4B (B:)
    dlkdaeavqkffleeiqlgeellaqgdyekgvdhltnaiavcgqpqqllqvlqqtlpppv
    fqmlltkl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >1wt4C (C:)
    gprlsrllsaagc
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >1wt4D (D:)
    gprlsrllsaagc