PDB entry 1wsz

View 1wsz on RCSB PDB site
Description: Mutant human ABO(H) blood group transferase A
Class: transferase
Keywords: transferase
Deposited on 2004-11-12, released 2004-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-06-20, with a file datestamp of 2012-06-15.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: 0.209
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histo-blood group ABO system transferase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16442 (1-End)
      • initiating methionine (0)
      • engineered mutation (11)
    Domains in SCOPe 2.07: d1wsza_
  • Heterogens: HG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wszA (A:)
    mvslprmvypqskvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfa
    ikkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevraykrwq
    dvsmrrmemisdfcerrflsevdylvcvdvdmefrdhvgveiltplfgtlhpgfygssre
    aftyerrpqsqayipkdegdfyylggffggsvqevqrltrachqammvdqangieavwhd
    eshlnkyllrhkptkvlspeylwdqqllgwpavlrklrftavpknhqavrnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wszA (A:)
    mvslprmvypqskvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfa
    ikkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevcerrfls
    evdylvcvdvdmefrdhvgveiltplfgtlhpgfygssreaftyerrpqsqayipkdegd
    fyylggffggsvqevqrltrachqammvdqangieavwhdeshlnkyllrhkptkvlspe
    ylwdqqllgwpavlrklrftavp