PDB entry 1wsy

View 1wsy on RCSB PDB site
Description: the tryptophan synthase multienzyme complex. exploring structure-function relationships with x-ray crystallography and mutagenesis
Deposited on 1988-09-19, released 1989-01-09
The last revision was dated 1999-03-22, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    no info in PDB for this chain
  • Chain 'B':
    no info in PDB for this chain
  • Heterogens: PLP

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1wsyA (A:)
    meryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdplad
    gptiqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceq
    vgvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrs
    gvtgaenrgalplhhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivki
    ieknlaspkqmlaelrsfvsamkaasra
    

    Sequence, based on observed residues (ATOM records):
    >1wsyA (A:)
    meryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsadgpt
    iqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceqvgv
    dsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllplhhli
    eklkeyhaapalqgfgisspeqvsaavragaagaisgsaivkiieknlaspkqmlaelrs
    fvsamkaa
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1wsyB (B:)
    mttllnpyfgefggmyvpqilmpalnqleeafvraqkdpefqaqfadllknyagrptalt
    kcqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasa
    lasallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgs
    yetahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigm
    fadfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysi
    sagldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalk
    mmreqpekeqllvvnlsgrgdkdiftvhdilkargli
    

    Sequence, based on observed residues (ATOM records):
    >1wsyB (B:)
    fgefggmyvpqilmpalnqleeafvraqkdpefqaqfadllknyagrptaltkcqnitag
    trttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasalasallgl
    kcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsyetahyml
    gtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmfadfindt
    svgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysisagldfps
    vgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkmmreqpek
    eqllvvnlsgrgdkdiftvhdilka