PDB entry 1wsx

View 1wsx on RCSB PDB site
Description: Solution structure of MCL-1
Class: apoptosis
Keywords: helical bundle, apoptosis, Bcl-2, BH3, Mcl-1
Deposited on 2004-11-12, released 2004-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myeloid cell leukemia sequence 1
    Species: Mus musculus [TaxId:10090]
    Gene: mcl-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P97287 (5-161)
      • cloning artifact (0-4)
    Domains in SCOPe 2.07: d1wsxa1, d1wsxa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wsxA (A:)
    gplgseddlyrqsleiisrylreqatgskdskplgeagaagrraletlrrvgdgvqrnhe
    tafqgmlrkldiknegdvksfsrvmvhvfkdgvtnwgrivtlisfgafvakhlksvnqes
    fieplaetitdvlvrtkrdwlvkqrgwdgfveffhvqdlegg