PDB entry 1wsv

View 1wsv on RCSB PDB site
Description: Crystal Structure of Human T-protein of Glycine Cleavage System
Deposited on 2004-11-11, released 2005-08-16
The last revision was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.171
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aminomethyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: GCST
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Aminomethyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: GCST
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, THH, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1wsvA (A:)
    aqevlrrtplydfhlahggkmvafagwslpvqyrdshtdshlhtrqhcslfdvshmlqtk
    ilgsdrvklmeslvvgdiaelrpnqgtlslftneaggilddlivtntseghlyvvsnagc
    wekdlalmqdkvrelqnqgrdvglevldnallalqgptaaqvlqagvaddlrklpfmtsa
    vmevfgvsgcrvtrcgytgedgveisvpvagavhlatailknpevklaglaardslrlea
    glclygndidehttpvegslswtlgkrrraamdfpgakvivpqlkgrvqrrrvglmcega
    pmrahspilnmegtkigtvtsgcpspslkknvamgyvpceysrpgtmllvevrrkqqmav
    vskmpfvptnyytlk
    

    Sequence, based on observed residues (ATOM records):
    >1wsvA (A:)
    vlrrtplydfhlahggkmvafagwslpvqyrdshtdshlhtrqhcslfdvshmlqtkilg
    sdrvklmeslvvgdiaelrpnqgtlslftneaggilddlivtntseghlyvvsnagcwek
    dlalmqdkvrelqnqgrdvglevldnallalqgptaaqvlqagvaddlrklpfmtsavme
    vfgvsgcrvtrcgytgedgveisvpvagavhlatailknpevklaglaardslrleaglc
    lygndidehttpvegslswtlgkrrraamdfpgakvivpqlkgrvqrrrvglmcegapmr
    ahspilnmegtkigtvtsgcpspslkknvamgyvpceysrpgtmllvevrrkqqmavvsk
    mpfvptnyytl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1wsvB (B:)
    aqevlrrtplydfhlahggkmvafagwslpvqyrdshtdshlhtrqhcslfdvshmlqtk
    ilgsdrvklmeslvvgdiaelrpnqgtlslftneaggilddlivtntseghlyvvsnagc
    wekdlalmqdkvrelqnqgrdvglevldnallalqgptaaqvlqagvaddlrklpfmtsa
    vmevfgvsgcrvtrcgytgedgveisvpvagavhlatailknpevklaglaardslrlea
    glclygndidehttpvegslswtlgkrrraamdfpgakvivpqlkgrvqrrrvglmcega
    pmrahspilnmegtkigtvtsgcpspslkknvamgyvpceysrpgtmllvevrrkqqmav
    vskmpfvptnyytlk
    

    Sequence, based on observed residues (ATOM records):
    >1wsvB (B:)
    vlrrtplydfhlahggkmvafagwslpvqyrdshtdshlhtrqhcslfdvshmlqtkilg
    sdrvklmeslvvgdiaelrpnqgtlslftneaggilddlivtntseghlyvvsnagcwek
    dlalmqdkvrelqnqgrdvglevldnallalqgptaaqvlqagvaddlrklpfmtsavme
    vfgvsgcrvtrcgytgedgveisvpvagavhlatailknpevklaglaardslrleaglc
    lygndidehttpvegslswtlgkrrraamdfpgakvivpqlkgrvqrrrvglmcegapmr
    ahspilnmegtkigtvtsgcpspslkknvamgyvpceysrpgtmllvevrrkqqmavvsk
    mpfvptnyytl