PDB entry 1wsu

View 1wsu on RCSB PDB site
Description: C-terminal domain of elongation factor selB complexed with SECIS RNA
Class: translation/RNA
Keywords: winged-helix, TRANSLATION/RNA COMPLEX
Deposited on 2004-11-11, released 2005-01-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.224
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Selenocysteine-specific elongation factor
    Species: Moorella thermoacetica [TaxId:1525]
    Gene: selB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46455 (1-123)
      • cloning artifact (0)
    Domains in SCOPe 2.06: d1wsua1, d1wsua2, d1wsua3
  • Chain 'B':
    Compound: Selenocysteine-specific elongation factor
    Species: Moorella thermoacetica [TaxId:1525]
    Gene: selB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46455 (1-End)
      • cloning artifact (0)
    Domains in SCOPe 2.06: d1wsub1, d1wsub2, d1wsub3
  • Chain 'C':
    Compound: Selenocysteine-specific elongation factor
    Species: Moorella thermoacetica [TaxId:1525]
    Gene: selB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1wsuc1, d1wsuc2
  • Chain 'D':
    Compound: Selenocysteine-specific elongation factor
    Species: Moorella thermoacetica [TaxId:1525]
    Gene: selB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1wsud1, d1wsud2
  • Chain 'E':
    Compound: 5'-r(*gp*gp*cp*gp*up*up*gp*cp*cp*gp*gp*up*cp*u*gp*gp*cp*ap*ap*cp*gp*cp*c)-3'
    Species: synthetic, synthetic
  • Chain 'F':
    Compound: 5'-r(*gp*gp*cp*gp*up*up*gp*cp*cp*gp*gp*up*cp*u*gp*gp*cp*ap*ap*cp*gp*cp*c)-3'
    Species: synthetic, synthetic
  • Chain 'G':
    Compound: 5'-r(*gp*gp*cp*gp*up*up*gp*cp*cp*gp*gp*up*cp*u*gp*gp*cp*ap*ap*cp*gp*cp*c)-3'
    Species: synthetic, synthetic
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wsuA (A:)
    gsetqkkllkdledkyrvsrwqppsfkevagsfnldpseleellhylvregvlvkindef
    ywhrqalgeareviknlastgpfglaeardalgssrkyvlplleyldqvkftrrvgdkrv
    vvgn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wsuB (B:)
    gsetqkkllkdledkyrvsrwqppsfkevagsfnldpseleellhylvregvlvkindef
    ywhrqalgeareviknlastgpfglaeardalgssrkyvlplleyldqvkftrrvgdkrv
    vvgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wsuB (B:)
    gsetqkkllkdledkyrvsrwqppsfkevagsfnldpseleellhylvregvlvkindef
    ywhrqalgeareviknlastgpfglaeardalgssrkyvlplleyldqvkftrrvgdkrv
    vv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1wsuC (C:)
    gsetqkkllkdledkyrvsrwqppsfkevagsfnldpseleellhylvregvlvkindef
    ywhrqalgeareviknlastgpfglaeardalgssrkyvlplleyldqvkftrrvgdkrv
    vvgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wsuC (C:)
    kllkdledkyrvsrwqppsfkevaeellhylvregvlvkindefywhrqalgearevikn
    lastgpfglaeardalgssrkyvlplleyldqvkftrkrvvv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1wsuD (D:)
    gsetqkkllkdledkyrvsrwqppsfkevagsfnldpseleellhylvregvlvkindef
    ywhrqalgeareviknlastgpfglaeardalgssrkyvlplleyldqvkftrrvgdkrv
    vvgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wsuD (D:)
    setqkkllkdledkyrvsrwqppsfkevagsfnldpseleellhylvregvlvkindefy
    whrqalgeareviknlagpfglaeardalgssrkyvlplleyldqvkftrrvgdkrvvvg
    n
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.