PDB entry 1wst

View 1wst on RCSB PDB site
Description: Crystal structure of multiple substrate aminotransferase (MsAT) from Thermococcus profundus
Class: transferase
Keywords: alpha and beta
Deposited on 2004-11-10, released 2005-10-25
The last revision prior to the SCOP 1.73 freeze date was dated 2005-10-25, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.189
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: multiple substrate aminotransferase
    Species: THERMOCOCCUS PROFUNDUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9V2W5
      • engineered (345)
    Domains in SCOP 1.73: d1wsta1
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wstA (A:)
    mkklekklsaepinfdsffsekamlmkasevrellklvetsdvislagglpapetfpvet
    ikkiavevleehadkalqygttkgftplrlalarwmekrydipmskveimtvagsqqald
    ligrvflnpgdpivveaptylaaiqafkyydpefisiplddkgmrvdlleekleelrkqg
    krvkivytvstfqnpagvtmsvdrrkkllelaneydflivedgpyselrysgeptppikh
    fddygrviylgtfskilapgfrigwvaahphlirkmeiakqsidlctntfgqaiawkyve
    ngyldehipkiiefykprrdamlealeeympegvewtkpeggmfvrvtlpegidtklmme
    ravakgvayvpgeaffvhrdkkntmrlnftyvpeetiregvrrlaetikeemkrvkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wstA (A:)
    infdsffsekamlmkasevrellklvetsdvislagglpapetfpvetikkiavevleeh
    adkalqygttkgftplrlalarwmekrydipmskveimtvagsqqaldligrvflnpgdp
    ivveaptylaaiqafkyydpefisiplddkgmrvdlleekleelrkqgkrvkivytvstf
    qnpagvtmsvdrrkkllelaneydflivedgpyselrysgeptppikhfddygrviylgt
    fskilapgfrigwvaahphlirkmeiakqsidlctntfgqaiawkyvengyldehipkii
    efykprrdamlealeeympegvewtkpeggmfvrvtlpegidtklmmeravakgvayvpg
    eaffvhrdkkntmrlnftyvpeetiregvrrlaetikeemkrv