PDB entry 1wsp

View 1wsp on RCSB PDB site
Description: Crystal structure of axin dix domain
Class: signaling protein
Keywords: signaling protein
Deposited on 2004-11-08, released 2006-02-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.246
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Axin 1 protein
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • GB AAC40066 (Start-83)
    Domains in SCOPe 2.07: d1wspa1
  • Chain 'B':
    Compound: Axin 1 protein
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • GB AAC40066 (0-83)
    Domains in SCOPe 2.07: d1wspb_
  • Chain 'C':
    Compound: Axin 1 protein
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • GB AAC40066 (0-83)
    Domains in SCOPe 2.07: d1wspc_
  • Heterogens: HG, BEZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1wspA (A:)
pcdsivvayyfcgepipyrtlvrgravtlgqfkelltkkgsyryyfkkvsdefdcgvvfe
evredeailpvfeekiigkvekvd

    Sequence, based on observed residues (ATOM records): (download) 
    >1wspA (A:)
cdsivvayyfcgepipyrtlvrgravtlgqfkelltkkgsyryyfkkvsdefdcgvvfee
vredeailpvfeekiigkvekvd

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1wspB (B:)
pcdsivvayyfcgepipyrtlvrgravtlgqfkelltkkgsyryyfkkvsdefdcgvvfe
evredeailpvfeekiigkvekvd

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1wspC (C:)
pcdsivvayyfcgepipyrtlvrgravtlgqfkelltkkgsyryyfkkvsdefdcgvvfe
evredeailpvfeekiigkvekvd