PDB entry 1wsi

View 1wsi on RCSB PDB site
Description: Crystal structure of E.coli RNase HI active site mutant (E48A/K87A/D134N)
Class: hydrolase
Keywords: RNase H, active-site mutant, X-ray crystallography, hydrolase
Deposited on 2004-11-07, released 2004-11-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.217
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease hi
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A7Y4
      • engineered (47)
      • engineered (86)
      • engineered (133)
    Domains in SCOPe 2.08: d1wsia_
  • Chain 'B':
    Compound: ribonuclease hi
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A7Y4
      • engineered (47)
      • engineered (86)
      • engineered (133)
    Domains in SCOPe 2.08: d1wsib_
  • Chain 'C':
    Compound: ribonuclease hi
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A7Y4 (Start-154)
      • engineered (47)
      • engineered (86)
      • engineered (133)
    Domains in SCOPe 2.08: d1wsic_
  • Chain 'D':
    Compound: ribonuclease hi
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A7Y4 (Start-154)
      • engineered (47)
      • engineered (86)
      • engineered (133)
    Domains in SCOPe 2.08: d1wsid_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wsiA (A:)
    mlkqveiftdgsclgnpgpggygailryrgrektfsagytrttnnrmalmaaivalealk
    ehcevilstdsqyvrqgitqwihnwkargwktadkkpvknvdlwqrldaalgqhqikwew
    vkghaghpenercnelaraaamnptledtgyqvev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wsiA (A:)
    lkqveiftdgsclgnpgpggygailryrgrektfsagytrttnnrmalmaaivalealke
    hcevilstdsqyvrqgitqwihnwkargwktadkkpvknvdlwqrldaalgqhqikwewv
    kgaghpenercnelaraaamnptledtgyqve
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wsiB (B:)
    mlkqveiftdgsclgnpgpggygailryrgrektfsagytrttnnrmalmaaivalealk
    ehcevilstdsqyvrqgitqwihnwkargwktadkkpvknvdlwqrldaalgqhqikwew
    vkghaghpenercnelaraaamnptledtgyqvev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wsiB (B:)
    lkqveiftdgsclgnpgpggygailryrgrektfsagytrttnnrmalmaaivalealke
    hcevilstdsqyvrqgitqwihnwkargwktadkkpvknvdlwqrldaalgqhqikwewv
    kghpenercnelaraaamnptledtgyqv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1wsiC (C:)
    mlkqveiftdgsclgnpgpggygailryrgrektfsagytrttnnrmalmaaivalealk
    ehcevilstdsqyvrqgitqwihnwkargwktadkkpvknvdlwqrldaalgqhqikwew
    vkghaghpenercnelaraaamnptledtgyqvev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wsiC (C:)
    lkqveiftdgsclgnpgpggygailryrgrektfsagytrttnnrmalmaaivalealke
    hcevilstdsqyvrqgitqwihnwkargwktadkkpvknvdlwqrldaalgqhqikwewv
    kgaghpenercnelaraaamnptledtgyqvev
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1wsiD (D:)
    mlkqveiftdgsclgnpgpggygailryrgrektfsagytrttnnrmalmaaivalealk
    ehcevilstdsqyvrqgitqwihnwkargwktadkkpvknvdlwqrldaalgqhqikwew
    vkghaghpenercnelaraaamnptledtgyqvev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wsiD (D:)
    lkqveiftdgsclgnpgpggygailryrgrektfsagytrttnnrmalmaaivalealke
    hcevilstdsqyvrqgitqwihnwkargwktadkkpvknvdlwqrldaalgqhqikwewv
    kgghpenercnelaraaamnptledtgyqvev