PDB entry 1wsf

View 1wsf on RCSB PDB site
Description: Co-crystal structure of E.coli RNase HI active site mutant (D134A*) with Mn2+
Class: hydrolase
Keywords: RNase H, active-site mutant, co-crystal structure with Mn2+, X-ray crystallography, metal fluctuation model, hydrolase
Deposited on 2004-11-05, released 2005-02-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.216
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease hi
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A7Y4 (0-154)
      • engineered (86)
      • engineered (133)
    Domains in SCOPe 2.08: d1wsfa1
  • Chain 'B':
    Compound: ribonuclease hi
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A7Y4 (0-154)
      • engineered (86)
      • engineered (133)
    Domains in SCOPe 2.08: d1wsfb_
  • Chain 'C':
    Compound: ribonuclease hi
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A7Y4 (0-154)
      • engineered (86)
      • engineered (133)
    Domains in SCOPe 2.08: d1wsfc_
  • Chain 'D':
    Compound: ribonuclease hi
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A7Y4 (0-154)
      • engineered (86)
      • engineered (133)
    Domains in SCOPe 2.08: d1wsfd_
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wsfA (A:)
    mlkqveiftdgsclgnpgpggygailryrgrektfsagytrttnnrmelmaaivalealk
    ehcevilstdsqyvrqgitqwihnwkargwktadkkpvknvdlwqrldaalgqhqikwew
    vkghaghpenercaelaraaamnptledtgyqvev
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wsfB (B:)
    mlkqveiftdgsclgnpgpggygailryrgrektfsagytrttnnrmelmaaivalealk
    ehcevilstdsqyvrqgitqwihnwkargwktadkkpvknvdlwqrldaalgqhqikwew
    vkghaghpenercaelaraaamnptledtgyqvev
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wsfC (C:)
    mlkqveiftdgsclgnpgpggygailryrgrektfsagytrttnnrmelmaaivalealk
    ehcevilstdsqyvrqgitqwihnwkargwktadkkpvknvdlwqrldaalgqhqikwew
    vkghaghpenercaelaraaamnptledtgyqvev
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wsfD (D:)
    mlkqveiftdgsclgnpgpggygailryrgrektfsagytrttnnrmelmaaivalealk
    ehcevilstdsqyvrqgitqwihnwkargwktadkkpvknvdlwqrldaalgqhqikwew
    vkghaghpenercaelaraaamnptledtgyqvev