PDB entry 1wse

View 1wse on RCSB PDB site
Description: Co-crystal structure of E.coli RNase HI active site mutant (E48A*) with Mn2+
Class: Hydrolase
Keywords: RNase H, active-site mutant, co-crystal structure with Mn2+, X-ray crystallography, metal fluctuation model
Deposited on 2004-11-05, released 2005-02-08
The last revision prior to the SCOP 1.73 freeze date was dated 2005-02-08, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.23
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease hi
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A7Y4 (0-154)
      • engineered (47)
      • engineered (86)
    Domains in SCOP 1.73: d1wsea1
  • Chain 'B':
    Compound: ribonuclease hi
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A7Y4 (0-154)
      • engineered (47)
      • engineered (86)
    Domains in SCOP 1.73: d1wseb1
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1wseA (A:)
mlkqveiftdgsclgnpgpggygailryrgrektfsagytrttnnrmalmaaivalealk
ehcevilstdsqyvrqgitqwihnwkargwktadkkpvknvdlwqrldaalgqhqikwew
vkghaghpenercdelaraaamnptledtgyqvev

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1wseB (B:)
mlkqveiftdgsclgnpgpggygailryrgrektfsagytrttnnrmalmaaivalealk
ehcevilstdsqyvrqgitqwihnwkargwktadkkpvknvdlwqrldaalgqhqikwew
vkghaghpenercdelaraaamnptledtgyqvev