PDB entry 1wsc

View 1wsc on RCSB PDB site
Description: Crystal structure of ST0229, function unknown protein from Sulfolobus tokodaii
Class: Structural genomics, unknown function
Keywords: Structural genomics, function unknown protein, unknown function
Deposited on 2004-11-05, released 2005-11-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.217
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein ST0229
    Species: Sulfolobus tokodaii [TaxId:111955]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q976G0
      • modified residue (162)
    Domains in SCOPe 2.07: d1wsca1
  • Chain 'B':
    Compound: Hypothetical protein ST0229
    Species: Sulfolobus tokodaii [TaxId:111955]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q976G0
      • modified residue (162)
    Domains in SCOPe 2.07: d1wscb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wscA (A:)
    msqeqlvavnelnenlgkvlikiardsianklgilkinledylsslndpilnkkglafvt
    letyygnstslrgcigyveavaplkeivskaaiaaafsdprfpplskgefdniiievtvl
    tkpqeidvenrwelpkkikvgedgliveygilysglllpqvpmeycwdeetflaetcika
    glepdcwlnnkvkikkfqgiifreekpksekiliikpsevkckkeeisll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wscA (A:)
    qeqlvavnelnenlgkvlikiardsianklgilkinledylsslndpilnkkglafvtle
    tyygnstslrgcigyveavaplkeivskaaiaaafsdprfpplskgefdniiievtvltk
    pqeidvenrwelpkkikvgedgliveygilysglllpqvpmeycwdeetflaetcikagl
    epdcwlnnkvkikkfqgiifreekpksekiliikpsevkckkeei
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wscB (B:)
    msqeqlvavnelnenlgkvlikiardsianklgilkinledylsslndpilnkkglafvt
    letyygnstslrgcigyveavaplkeivskaaiaaafsdprfpplskgefdniiievtvl
    tkpqeidvenrwelpkkikvgedgliveygilysglllpqvpmeycwdeetflaetcika
    glepdcwlnnkvkikkfqgiifreekpksekiliikpsevkckkeeisll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wscB (B:)
    lvavnelnenlgkvlikiardsianklgilkinledylsslndpilnkkglafvtletyy
    gnstslrgcigyveavaplkeivskaaiaaafsdprfpplskgefdniiievtvltkpqe
    idvenrwelpkkikvgedgliveygilysglllpqvpmeycwdeetflaetcikaglepd
    cwlnnkvkikkfqgiifreekpksekiliikpse