PDB entry 1wsb

View 1wsb on RCSB PDB site
Description: Flavodoxin mutant- S64C
Class: electron transport
Keywords: flavodoxin monomer, mutant, redox protein, electron transport
Deposited on 2004-11-05, released 2004-11-23
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-12-22, with a file datestamp of 2010-12-17.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.174
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: flavodoxin
    Species: Desulfovibrio vulgaris [TaxId:881]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00323 (Start-147)
      • see remark 999 (1)
      • engineered (63)
    Domains in SCOPe 2.01: d1wsba_
  • Heterogens: FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wsbA (A:)
    makalivygsttgnteytaetiareladagyevdsrdaasveagglfegfdlvllgcstw
    gddcielqddfiplfdsleetgaqgrkvacfgcgdssyeyfcgavdaieeklknlgaeiv
    qdglridgdpraarddivgwahdvrgai
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wsbA (A:)
    akalivygsttgnteytaetiareladagyevdsrdaasveagglfegfdlvllgcstwg
    ddcielqddfiplfdsleetgaqgrkvacfgcgdssyeyfcgavdaieeklknlgaeivq
    dglridgdpraarddivgwahdvrgai