PDB entry 1ws9

View 1ws9 on RCSB PDB site
Description: Crystal structure of project ID TT0172 from Thermus thermophilus HB8
Class: oxidoreductase
Keywords: dehydrogenase, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, OXIDOREDUCTASE
Deposited on 2004-11-02, released 2005-10-18
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.18
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acyl-CoA dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1ws9a1, d1ws9a2
  • Chain 'B':
    Compound: acyl-CoA dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1ws9b1, d1ws9b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ws9A (A:)
    mglwfeegaeerqvlgpfreflkaevapgaaerdrtgafpwdlvrklaefgvfgalvpea
    yggaglstrlfarmveaiayydgalaltvashnslatghillagseaqkeaflpklasge
    algawgltepgsgsdaaalktkaekveggwrlngtkqfitqgsvagvyvvmartdpppsp
    erkhqgisafaffrperglkvgrkeeklgltasdtaqliledlfvpeeallgergkgfyd
    vlrvldggrigiaamavglgqaaldyalayakgreafgrpiaefegvsfklaeaatelea
    arllylkaaelkdagrpftleaaqaklfaseaavkacdeaiqilggygyvkdypverywr
    darltrigegtseilklviarrlleav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ws9A (A:)
    glwfeegaeerqvlgpfreflkaevapgaaerdrtgafpwdlvrklaefgvfgalvpeay
    ggaglstrlfarmveaiayydgalaltvashnslatghillagseaqkeaflpklasgea
    lgawgltepgsgsdaaalktkaekveggwrlngtkqfitqgsvagvyvvmartdpppspe
    rkhqgisafaffrperglkvgrkeeklgltasdtaqliledlfvpeeallgergkgfydv
    lrvldggrigiaamavglgqaaldyalayakgreafgrpiaefegvsfklaeaateleaa
    rllylkaaelkdagrpftleaaqaklfaseaavkacdeaiqilggygyvkdypverywrd
    arltrigegtseilklviarrlleav
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ws9B (B:)
    mglwfeegaeerqvlgpfreflkaevapgaaerdrtgafpwdlvrklaefgvfgalvpea
    yggaglstrlfarmveaiayydgalaltvashnslatghillagseaqkeaflpklasge
    algawgltepgsgsdaaalktkaekveggwrlngtkqfitqgsvagvyvvmartdpppsp
    erkhqgisafaffrperglkvgrkeeklgltasdtaqliledlfvpeeallgergkgfyd
    vlrvldggrigiaamavglgqaaldyalayakgreafgrpiaefegvsfklaeaatelea
    arllylkaaelkdagrpftleaaqaklfaseaavkacdeaiqilggygyvkdypverywr
    darltrigegtseilklviarrlleav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ws9B (B:)
    glwfeegaeerqvlgpfreflkaevapgaaerdrtgafpwdlvrklaefgvfgalvpeay
    ggaglstrlfarmveaiayydgalaltvashnslatghillagseaqkeaflpklasgea
    lgawgltepgsgsdaaalktkaekveggwrlngtkqfitqgsvagvyvvmartdpppspe
    rkhqgisafaffrperglkvgrkeeklgltasdtaqliledlfvpeeallgergkgfydv
    lrvldggrigiaamavglgqaaldyalayakgreafgrpiaefegvsfklaeaateleaa
    rllylkaaelkdagrpftleaaqaklfaseaavkacdeaiqilggygyvkdypverywrd
    arltrigegtseilklviarrlleav