PDB entry 1ws8

View 1ws8 on RCSB PDB site
Description: Crystal Structure of Mavicyanin from Cucurbita pepo medullosa (Zucchini)
Deposited on 2004-11-02, released 2004-11-23
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-23, with a file datestamp of 2004-11-23.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.193
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1ws8a_
  • Chain 'B':
    Domains in SCOP 1.71: d1ws8b_
  • Chain 'C':
    Domains in SCOP 1.71: d1ws8c_
  • Chain 'D':
    Domains in SCOP 1.71: d1ws8d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ws8A (A:)
    matvhkvgdstgwttlvpydyakwassnkfhvgdsllfnynnkfhnvlqvdqeqfkscns
    sspaasytsgadsiplkrpgtfyflcgipghcqlgqkveikvdpgsssa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ws8A (A:)
    matvhkvgdstgwttlvpydyakwassnkfhvgdsllfnynnkfhnvlqvdqeqfkscns
    sspaasytsgadsiplkrpgtfyflcgipghcqlgqkveikvdp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ws8B (B:)
    matvhkvgdstgwttlvpydyakwassnkfhvgdsllfnynnkfhnvlqvdqeqfkscns
    sspaasytsgadsiplkrpgtfyflcgipghcqlgqkveikvdpgsssa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ws8B (B:)
    matvhkvgdstgwttlvpydyakwassnkfhvgdsllfnynnkfhnvlqvdqeqfkscns
    sspaasytsgadsiplkrpgtfyflcgipghcqlgqkveikvd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ws8C (C:)
    matvhkvgdstgwttlvpydyakwassnkfhvgdsllfnynnkfhnvlqvdqeqfkscns
    sspaasytsgadsiplkrpgtfyflcgipghcqlgqkveikvdpgsssa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ws8C (C:)
    matvhkvgdstgwttlvpydyakwassnkfhvgdsllfnynnkfhnvlqvdqeqfkscns
    sspaasytsgadsiplkrpgtfyflcgipghcqlgqkveikvd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ws8D (D:)
    matvhkvgdstgwttlvpydyakwassnkfhvgdsllfnynnkfhnvlqvdqeqfkscns
    sspaasytsgadsiplkrpgtfyflcgipghcqlgqkveikvdpgsssa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ws8D (D:)
    matvhkvgdstgwttlvpydyakwassnkfhvgdsllfnynnkfhnvlqvdqeqfkscns
    sspaasytsgadsiplkrpgtfyflcgipghcqlgqkveikvd