PDB entry 1ws7

View 1ws7 on RCSB PDB site
Description: crystal structure of mavicyanin from cucurbita pepo medullosa (zucchini)
Deposited on 2004-11-02, released 2004-11-23
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-23, with a file datestamp of 2004-11-23.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.188
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1ws7a_
  • Chain 'B':
    Domains in SCOP 1.71: d1ws7b_
  • Chain 'C':
    Domains in SCOP 1.71: d1ws7c_
  • Chain 'D':
    Domains in SCOP 1.71: d1ws7d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ws7A (A:)
    matvhkvgdstgwttlvpydyakwassnkfhvgdsllfnynnkfhnvlqvdqeqfkscns
    sspaasytsgadsiplkrpgtfyflcgipghcqlgqkveikvdpgsssa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ws7A (A:)
    matvhkvgdstgwttlvpydyakwassnkfhvgdsllfnynnkfhnvlqvdqeqfkscns
    sspaasytsgadsiplkrpgtfyflcgipghcqlgqkveikvdpgss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ws7B (B:)
    matvhkvgdstgwttlvpydyakwassnkfhvgdsllfnynnkfhnvlqvdqeqfkscns
    sspaasytsgadsiplkrpgtfyflcgipghcqlgqkveikvdpgsssa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ws7B (B:)
    matvhkvgdstgwttlvpydyakwassnkfhvgdsllfnynnkfhnvlqvdqeqfkscns
    sspaasytsgadsiplkrpgtfyflcgipghcqlgqkveikvd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ws7C (C:)
    matvhkvgdstgwttlvpydyakwassnkfhvgdsllfnynnkfhnvlqvdqeqfkscns
    sspaasytsgadsiplkrpgtfyflcgipghcqlgqkveikvdpgsssa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ws7C (C:)
    matvhkvgdstgwttlvpydyakwassnkfhvgdsllfnynnkfhnvlqvdqeqfkscns
    sspaasytsgadsiplkrpgtfyflcgipghcqlgqkveikvd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ws7D (D:)
    matvhkvgdstgwttlvpydyakwassnkfhvgdsllfnynnkfhnvlqvdqeqfkscns
    sspaasytsgadsiplkrpgtfyflcgipghcqlgqkveikvdpgsssa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ws7D (D:)
    matvhkvgdstgwttlvpydyakwassnkfhvgdsllfnynnkfhnvlqvdqeqfkscns
    sspaasytsgadsiplkrpgtfyflcgipghcqlgqkveikvdpg