PDB entry 1ws6

View 1ws6 on RCSB PDB site
Description: The Structure of Thermus thermphillus HB8 hypothetical protein TTHA0928
Class: transferase
Keywords: methyltransferase, STRUCTURAL GENOMICS, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-11-01, released 2006-02-07
The last revision prior to the SCOP 1.75 freeze date was dated 2006-02-07, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.218
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Methyltransferase
  Species: Thermus thermophilus HB8
  Database cross-references and differences (RAF-indexed):
  • GB BAD70751 (0-170)
    • conflict (47)
    • modified residue (115)
    • modified residue (121)
  Domains in SCOP 1.75: d1ws6a1
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ws6A (A:)
  vvrilggkargvalkvpasarpspvrlrkalfdylrlryprrgrfldpfagsgavgleaa
  segweavlvekdpeavrllkenvrrtglgarvvalpvevflpeakaqgerftvafmappy
  amdlaalfgellasglveagglyvlqhpkdlylplgerrvygenaltlvev