PDB entry 1ws4

View 1ws4 on RCSB PDB site
Description: crystal structure of jacalin- me-alpha-mannose complex: promiscuity vs specificity
Deposited on 2004-10-31, released 2005-03-29
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: agglutinin alpha chain
    Species: Artocarpus integer [TaxId:3490]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18670 (0-132)
      • conflict (44)
  • Chain 'B':
    Compound: Agglutinin beta-3 chain
    Species: Artocarpus integer [TaxId:3490]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: agglutinin alpha chain
    Species: Artocarpus integer [TaxId:3490]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Agglutinin beta-3 chain
    Species: Artocarpus integer [TaxId:3490]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: agglutinin alpha chain
    Species: Artocarpus integer [TaxId:3490]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Agglutinin beta-3 chain
    Species: Artocarpus integer [TaxId:3490]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18673 (Start-19)
      • conflict (18-19)
  • Chain 'G':
    Compound: agglutinin alpha chain
    Species: Artocarpus integer [TaxId:3490]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18670 (0-132)
      • conflict (44)
  • Chain 'H':
    Compound: Agglutinin beta-3 chain
    Species: Artocarpus integer [TaxId:3490]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GYP, AMG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1ws4A (A:)
    gkafddgaftgireinlsynketaigdfqvvydlngspyvgqnhvsfitgftpvkisldf
    pseyimevsgytgnvsgyvvvrsltfktnkktygpygvtsgtpfnlpienglivgfkgsi
    gywldyfsmylsl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1ws4B (B:)
    deqsgisqtvivgpwgaksa
    

    Sequence, based on observed residues (ATOM records):
    >1ws4B (B:)
    qsgisqtvivgpwgak
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >1ws4C (C:)
    gkafddgaftgireinlsynketaigdfqvvydlngspyvgqnhksfitgftpvkisldf
    pseyimevsgytgnvsgyvvvrsltfktnkktygpygvtsgtpfnlpienglivgfkgsi
    gywldyfsmylsl
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >1ws4D (D:)
    deqsgisqtvivgpwgaksa
    

    Sequence, based on observed residues (ATOM records):
    >1ws4D (D:)
    qsgisqtvivgpwgak
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records:
    >1ws4E (E:)
    gkafddgaftgireinlsynketaigdfqvvydlngspyvgqnhksfitgftpvkisldf
    pseyimevsgytgnvsgyvvvrsltfktnkktygpygvtsgtpfnlpienglivgfkgsi
    gywldyfsmylsl
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >1ws4F (F:)
    deqsgisqtvivgpwgaksa
    

    Sequence, based on observed residues (ATOM records):
    >1ws4F (F:)
    qsgisqtvivgpwgaksa
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records:
    >1ws4G (G:)
    gkafddgaftgireinlsynketaigdfqvvydlngspyvgqnhvsfitgftpvkisldf
    pseyimevsgytgnvsgyvvvrsltfktnkktygpygvtsgtpfnlpienglivgfkgsi
    gywldyfsmylsl
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >1ws4H (H:)
    deqsgisqtvivgpwgaksa
    

    Sequence, based on observed residues (ATOM records):
    >1ws4H (H:)
    qsgisqtvivgpwgak