PDB entry 1ws1

View 1ws1 on RCSB PDB site
Description: Structure analysis of peptide deformylase from Bacillus cereus
Class: hydrolase
Keywords: Alpha+Beta topology, actinonin complex, hydrolase
Deposited on 2004-10-29, released 2005-09-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.184
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptide deformylase 1
    Species: Bacillus cereus [TaxId:1396]
    Gene: DEF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ws1a_
  • Heterogens: NI, BB2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ws1A (A:)
    mavleiikhpnevletpcervinfdkklvkllkdmhetmliadgvglaapqvgvslqvav
    vdvdddtgkielinpsilekrgeqvgpegclsfpglygeveradyikvraqnrrgkvfll
    eaegflaraiqheidhlhgvlftskvtryyeenele
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ws1A (A:)
    mavleiikhpnevletpcervinfdkklvkllkdmhetmliadgvglaapqvgvslqvav
    vdvdddtgkielinpsilekrgeqvgpegclsfpglygeveradyikvraqnrrgkvfll
    eaegflaraiqheidhlhgvlftskvtryye