PDB entry 1wrt

View 1wrt on RCSB PDB site
Description: nmr study of apo trp repressor
Class: operon repressor
Keywords: operon repressor, transcription regulation, DNA-binding
Deposited on 1995-05-12, released 1996-06-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'R':
    Compound: apo trp repressor
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1wrtr_
  • Chain 'S':
    Compound: apo trp repressor
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1wrts_

PDB Chain Sequences:

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1wrtR (R:)
    qspysaamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvriveellr
    gemsqrelknelgagiatitrgsnslkaapvelrqwleevllksd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wrtR (R:)
    qspysaamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvriveellr
    gemsqrelknelgagiatitrgsnslkaapvelrqwleevllks
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1wrtS (S:)
    qspysaamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvriveellr
    gemsqrelknelgagiatitrgsnslkaapvelrqwleevllksd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wrtS (S:)
    qspysaamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvriveellr
    gemsqrelknelgagiatitrgsnslkaapvelrqwleevllks