PDB entry 1wrs

View 1wrs on RCSB PDB site
Description: nmr study of holo trp repressor
Class: complex (operon repressor/peptide)
Keywords: operon repressor, transcription regulation, DNA-binding, peptide, complex (operon repressor/peptide) complex
Deposited on 1995-05-12, released 1996-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'R':
    Compound: holo trp repressor
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wrsr_
  • Chain 'S':
    Compound: holo trp repressor
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wrss_
  • Heterogens: TRP

PDB Chain Sequences:

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1wrsR (R:)
    qspysaamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvriveellr
    gemsqrelknelgagiatitrgsnslkaapvelrqwleevllksd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wrsR (R:)
    qspysaamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvriveellr
    gemsqrelknelgagiatitrgsnslkaapvelrqwleevllks
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1wrsS (S:)
    qspysaamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvriveellr
    gemsqrelknelgagiatitrgsnslkaapvelrqwleevllksd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wrsS (S:)
    qspysaamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvriveellr
    gemsqrelknelgagiatitrgsnslkaapvelrqwleevllks