PDB entry 1wrq

View 1wrq on RCSB PDB site
Description: Crystal Structure of HutP-Antitermination complex
Class: transcription/RNA
Keywords: HutP, RNA binding protein, Antitermination, L-histidine, metal ions, conformational change, TRANSCRIPTION/RNA COMPLEX
Deposited on 2004-10-25, released 2005-08-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.198
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hut operon positive regulatory protein
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10943 (0-146)
      • engineered (49)
    Domains in SCOPe 2.07: d1wrqa_
  • Chain 'B':
    Compound: Hut operon positive regulatory protein
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10943 (0-146)
      • engineered (49)
    Domains in SCOPe 2.07: d1wrqb_
  • Chain 'C':
    Compound: 5'-r(*up*up*up*ap*gp*up*u)-3'
  • Chain 'D':
    Compound: 5'-r(*up*up*up*ap*gp*up*u)-3'
  • Heterogens: MG, HIS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wrqA (A:)
    tlhkerrigrlsvllllneaeestqveelerdgwkvclgkvgsmdahkviaaietaskks
    gviqsegyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwi
    avslygtigapikglehetfgvginhi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wrqA (A:)
    tlhkerrigrlsvllllnstqveelerdgwkvclgkvgsmdahkviaaietaskksgviq
    segyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwiavsl
    ygtigapikglehetfgvginhi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wrqB (B:)
    tlhkerrigrlsvllllneaeestqveelerdgwkvclgkvgsmdahkviaaietaskks
    gviqsegyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwi
    avslygtigapikglehetfgvginhi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wrqB (B:)
    tlhkerrigrlsvllllnetqveelerdgwkvclgkvgsmdahkviaaietaskksgviq
    segyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwiavsl
    ygtigapikglehetfgvginhi
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.