PDB entry 1wrp

View 1wrp on RCSB PDB site
Description: flexibility of the DNA-binding domains of trp repressor
Class: DNA binding regulatory protein
Keywords: DNA binding regulatory protein
Deposited on 1987-12-01, released 1988-04-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.204
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'R':
    Compound: trp repressor
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wrpr_
  • Heterogens: TRP, HOH

PDB Chain Sequences:

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1wrpR (R:)
    aqqspysaamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvriveel
    lrgemsqrelknelgagiatitrgsnslkaapvelrqwleevllksd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wrpR (R:)
    qspysaamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvriveellr
    gemsqrelknelgagiatitrgsnslkaapvelrqwleevll