PDB entry 1wro

View 1wro on RCSB PDB site
Description: Metal Ion dependency of the antiterminator protein, HutP, for binding to the terminator region of hut mRNA- A structural basis
Class: RNA binding protein
Keywords: HutP, RNA binding protein, Antitermination, L-histidine, metal ions, conformational change
Deposited on 2004-10-25, released 2005-08-30
The last revision prior to the SCOP 1.75 freeze date was dated 2005-10-11, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.247
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hut operon positive regulatory protein
    Species: Bacillus subtilis
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10943 (0-146)
      • engineered (49)
    Domains in SCOP 1.75: d1wroa1
  • Chain 'B':
    Compound: Hut operon positive regulatory protein
    Species: Bacillus subtilis
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10943 (0-146)
      • engineered (49)
    Domains in SCOP 1.75: d1wrob1
  • Chain 'C':
    Compound: Hut operon positive regulatory protein
    Species: Bacillus subtilis
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10943 (0-146)
      • engineered (49)
    Domains in SCOP 1.75: d1wroc1
  • Heterogens: BA, HIS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1wroA (A:)
tlhkerrigrlsvllllneaeestqveelerdgwkvclgkvgsmdahkviaaietaskks
gviqsegyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwi
avslygtigapikglehetfgvginhi

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1wroB (B:)
tlhkerrigrlsvllllneaeestqveelerdgwkvclgkvgsmdahkviaaietaskks
gviqsegyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwi
avslygtigapikglehetfgvginhi

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1wroC (C:)
tlhkerrigrlsvllllneaeestqveelerdgwkvclgkvgsmdahkviaaietaskks
gviqsegyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwi
avslygtigapikglehetfgvginhi