PDB entry 1wrm

View 1wrm on RCSB PDB site
Description: Crystal structure of JSP-1
Class: hydrolase
Keywords: phosphatase, DSP, JNK, HYDROLASE
Deposited on 2004-10-22, released 2005-10-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.251
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dual specificity phosphatase 22
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NRW4 (2-End)
      • cloning artifact (0-1)
    Domains in SCOPe 2.07: d1wrma1, d1wrma2
  • Heterogens: MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wrmA (A:)
    gpmgngmnkilpglyignfkdardaeqlsknkvthilsvhdsarpmlegvkylcipaads
    psqnltrhfkesikfihecrlrgesclvhclagvsrsvtlviayimtvtdfgwedalhtv
    ragrscanpnvgfqrqlqefekhevhqyrqwlkeeygesplqdae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wrmA (A:)
    gpmgngmnkilpglyignfkdardaeqlsknkvthilsvhdsarpmlegvkylcipaads
    psqnltrhfkesikfihecrlrgesclvhclagvsrsvtlviayimtvtdfgwedalhtv
    ragrscanpnvgfqrqlqefekhevhqyrqwlkeey