PDB entry 1wrl

View 1wrl on RCSB PDB site
Description: Crystal structure of the N-terminal domain of human cardiac troponin C in complex with trifluoperazine (monoclinic crystal form)
Class: contractile protein
Keywords: EF-hand, CONTRACTILE PROTEIN
Deposited on 2004-10-20, released 2006-01-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.24
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: troponin c, slow skeletal and cardiac muscles
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63316
      • engineered (34)
      • engineered (83)
    Domains in SCOPe 2.07: d1wrla_
  • Chain 'B':
    Compound: troponin c, slow skeletal and cardiac muscles
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63316
      • engineered (34)
      • engineered (83)
    Domains in SCOPe 2.07: d1wrlb_
  • Chain 'C':
    Compound: troponin c, slow skeletal and cardiac muscles
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63316
      • engineered (34)
      • engineered (83)
    Domains in SCOPe 2.07: d1wrlc_
  • Chain 'D':
    Compound: troponin c, slow skeletal and cardiac muscles
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63316
      • engineered (34)
      • engineered (83)
    Domains in SCOPe 2.07: d1wrld_
  • Chain 'E':
    Compound: troponin c, slow skeletal and cardiac muscles
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63316
      • engineered (34)
      • engineered (83)
    Domains in SCOPe 2.07: d1wrle_
  • Chain 'F':
    Compound: troponin c, slow skeletal and cardiac muscles
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63316
      • engineered (34)
      • engineered (83)
    Domains in SCOPe 2.07: d1wrlf_
  • Heterogens: CA, TFP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wrlA (A:)
    mddiykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlgqnptpeelqem
    idevdedgsgtvdfdeflvmmvrsmkdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wrlA (A:)
    iykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlgqnptpeelqemide
    vdedgsgtvdfdeflvmmvrsm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wrlB (B:)
    mddiykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlgqnptpeelqem
    idevdedgsgtvdfdeflvmmvrsmkdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wrlB (B:)
    diykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlgqnptpeelqemid
    evdedgsgtvdfdeflvmmvrsm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1wrlC (C:)
    mddiykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlgqnptpeelqem
    idevdedgsgtvdfdeflvmmvrsmkdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wrlC (C:)
    diykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlgqnptpeelqemid
    evdedgsgtvdfdeflvmmvrsm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1wrlD (D:)
    mddiykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlgqnptpeelqem
    idevdedgsgtvdfdeflvmmvrsmkdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wrlD (D:)
    diykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlgqnptpeelqemid
    evdedgsgtvdfdeflvmmvrs
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1wrlE (E:)
    mddiykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlgqnptpeelqem
    idevdedgsgtvdfdeflvmmvrsmkdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wrlE (E:)
    diykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlgqnptpeelqemid
    evdedgsgtvdfdeflvmmvrsm
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1wrlF (F:)
    mddiykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlgqnptpeelqem
    idevdedgsgtvdfdeflvmmvrsmkdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wrlF (F:)
    diykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlgqnptpeelqemid
    evdedgsgtvdfdeflvmmvrs