PDB entry 1wrk

View 1wrk on RCSB PDB site
Description: Crystal structure of the N-terminal domain of human cardiac troponin C in complex with trifluoperazine (orthrombic crystal form)
Class: contractile protein
Keywords: EF-hand, CONTRACTILE PROTEIN
Deposited on 2004-10-20, released 2006-01-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.23
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: troponin c, slow skeletal and cardiac muscles
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63316
      • engineered (34)
      • engineered (83)
    Domains in SCOPe 2.07: d1wrka_
  • Chain 'B':
    Compound: troponin c, slow skeletal and cardiac muscles
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63316
      • engineered (34)
      • engineered (83)
    Domains in SCOPe 2.07: d1wrkb_
  • Heterogens: CA, TFP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wrkA (A:)
    mddiykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlgqnptpeelqem
    idevdedgsgtvdfdeflvmmvrsmkdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wrkA (A:)
    iykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlgqnptpeelqemide
    vdedgsgtvdfdeflvmmvrsm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wrkB (B:)
    mddiykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlgqnptpeelqem
    idevdedgsgtvdfdeflvmmvrsmkdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wrkB (B:)
    iykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlgqnptpeelqemide
    vdedgsgtvdfdeflvmmvrs