PDB entry 1wrj

View 1wrj on RCSB PDB site
Description: Crystal structure of O6-methylguanine methyltransferase from Sulfolobus tokodaii
Deposited on 2004-10-18, released 2005-12-06
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.189
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methylated-DNA--protein-cysteine methyltransferase
    Species: Sulfolobus tokodaii [TaxId:111955]
    Gene: ST0967
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1wrjA (A:)
    mivyglykspfgpitvaknekgfvmldfcdcaerssldndyftdffykldlyfegkkvdl
    tepvdfkpfnefrirvfkevmrikwgevrtykqvadavktspravgtalsknnvlliipc
    hrvigekslggysrgvelkrkllelegidvakfiek
    

    Sequence, based on observed residues (ATOM records):
    >1wrjA (A:)
    mivyglykspfgpitvaknekgfvmldfcdcaerssldndyftdffykldlyfegkkvdl
    tepvdfkpfnefrirvfkevmrikwgevrtykqvadavktspravgtalsknnvlliipc
    hrvigekslggysrgvelkrkllelegidv