PDB entry 1wrg

View 1wrg on RCSB PDB site
Description: Light-Harvesting Complex 1 Beta Subunit from Wild-Type Rhodospirillum rubrum
Class: membrane protein
Keywords: Membrane protein, Light-harvesting, Pigment binding, Photosynthesis
Deposited on 2004-10-15, released 2005-03-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Light-harvesting protein B-880, beta chain
    Species: Rhodospirillum rubrum [TaxId:1085]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1wrga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wrgA (A:)
    aevkqeslsgitegeakefhkiftssilvffgvaafahllvwiwrpwvpgpngys